IL36 beta (IL36B) (NM_173178) Human Recombinant Protein
CAT#: TP311037
Recombinant protein of human interleukin 1 family, member 8 (eta) (IL1F8), transcript variant 2, 20 µg
View other "IL36 beta" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211037 protein sequence
Red=Cloning site Green=Tags(s) MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKD LCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLT KERGITNNTNFYLDSVE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_775270 |
Locus ID | 27177 |
UniProt ID | Q9NZH7 |
Cytogenetics | 2q14.1 |
Refseq Size | 1068 |
Refseq ORF | 471 |
Synonyms | FIL1; FIL1-(ETA); FIL1H; FILI-(ETA); IL-1F8; IL-1H2; IL1-ETA; IL1F8; IL1H2 |
Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406635 | IL36B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406635 | Transient overexpression lysate of interleukin 1 family, member 8 (eta) (IL1F8), transcript variant 2 |
USD 436.00 |
|
PH311037 | IL1F8 MS Standard C13 and N15-labeled recombinant protein (NP_775270) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review