nkx6.2 (NKX6-2) (NM_177400) Human Recombinant Protein

CAT#: TP310963

Recombinant protein of human NK6 homeobox 2 (NKX6-2), 20 µg

Product Images

Coomassie blue staining of purified NKX6-2 protein (Cat# TP310963). The protein was produced from HEK293T cells transfected with NKX6-2 cDNA clone (Cat# RC210963) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210963 representing NM_177400
  Red=Cloning site Green=Tags(s)
  
  MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDILGRPVGA
  AGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGAPWRDPRLAGPAPAGG
  VLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAE
  MASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDAL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_796374
• Locus ID: 84504
• UniProt ID: Q9C056
• Cytogenetics: 10q26.3
• Refseq Size: 834
• Refseq ORF: 831
• Synonyms: GTX; NKX6.2; NKX6B; SPAX8
• Summary: Transcription factor with repressor activity involved in the regulation of axon-glial interactions at myelin paranodes in oligodendrocytes. Binds to the consensus DNA sequence 5'-(A/T)TTAATGA-3'. In oligodendrocytes, binds to MBP and PLP1 promoter regions.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors