PRELP (NM_201348) Human Recombinant Protein
CAT#: TP307609
Purified recombinant protein of Homo sapiens proline/arginine-rich end leucine-rich repeat protein (PRELP), transcript variant 2, 20 µg
View other "PRELP" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207609 protein sequence
Red=Cloning site Green=Tags(s) MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPPPLPPGPPSIF PDCPRECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVESFQNATGLRWINLDNNRIRK IDQRVLEKLPGLVFLYMEKNQLEEVPSALPRNLEQLRLSQNHISRIPPGVFSKLENLLLLDLQHNRLSDG VFKPDTFHGLKNLMQLNLAHNILRKMPPRVPTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTD RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVP HLRYLRLDGNYLKPPIPLDLMMCFRLLQSVVI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_958505 |
Locus ID | 5549 |
UniProt ID | P51888 |
Cytogenetics | 1q32.1 |
Refseq Size | 5823 |
Refseq ORF | 1146 |
Synonyms | MST161; MSTP161; SLRR2A |
Summary | The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400959 | PRELP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404518 | PRELP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400959 | Transient overexpression lysate of proline/arginine-rich end leucine-rich repeat protein (PRELP), transcript variant 1 |
USD 436.00 |
|
LY404518 | Transient overexpression lysate of proline/arginine-rich end leucine-rich repeat protein (PRELP), transcript variant 2 |
USD 436.00 |
|
PH307609 | PRELP MS Standard C13 and N15-labeled recombinant protein (NP_958505) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review