FHIT (NM_002012) Human Recombinant Protein
CAT#: TP307120
Recombinant protein of human fragile histidine triad gene (FHIT), 20 µg
View other "FHIT" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207120 protein sequence
Red=Cloning site Green=Tags(s) MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE KHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAA ALRVYFQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002003 |
Locus ID | 2272 |
UniProt ID | P49789, A0A024R366 |
Cytogenetics | 3p14.2 |
Refseq Size | 1103 |
Refseq ORF | 441 |
Synonyms | AP3Aase; FRA3B |
Summary | The protein encoded by this gene is a P1-P3-bis(5'-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. The encoded protein is also a tumor suppressor, as loss of its activity results in replication stress and DNA damage. [provided by RefSeq, Aug 2017] |
Protein Pathways | Non-small cell lung cancer, Purine metabolism, Small cell lung cancer |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419588 | FHIT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431768 | FHIT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419588 | Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 1 |
USD 436.00 |
|
LY431768 | Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 2 |
USD 436.00 |
|
PH307120 | FHIT MS Standard C13 and N15-labeled recombinant protein (NP_002003) |
USD 3,255.00 |
|
TP328740 | Recombinant protein of human fragile histidine triad gene (FHIT), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review