IL3RA (NM_002183) Human Recombinant Protein
CAT#: TP306420
Recombinant protein of human interleukin 3 receptor, alpha (low affinity) (IL3RA), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206420 representing NM_002183
Red=Cloning site Green=Tags(s) MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQF GAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYL NVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTP PNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYE FLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQ NDKLVVWEAGKAGLEECLVTEVQVVQKT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002174 |
Locus ID | 3563 |
UniProt ID | P26951 |
Cytogenetics | X;Y |
Refseq Size | 1726 |
Refseq ORF | 1134 |
Synonyms | CD123; hIL-3Ra; IL3R; IL3RAY; IL3RX; IL3RY |
Summary | The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. Alternatively spliced transcript variants encoding distinct isoforms have been found. [provided by RefSeq, Jun 2012] |
Protein Families | Transmembrane |
Protein Pathways | Apoptosis, Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419481 | IL3RA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419481 | Transient overexpression lysate of interleukin 3 receptor, alpha (low affinity) (IL3RA) |
USD 436.00 |
|
PH306420 | IL3RA MS Standard C13 and N15-labeled recombinant protein (NP_002174) |
USD 3,255.00 |
|
TP723926 | Human CD123 Protein, hFc-His Tag |
USD 545.00 |
|
TP762389 | Purified recombinant protein of Human interleukin 3 receptor, alpha (low affinity) (IL3RA), Thr19-Arg305, with N-terminal His tag, expressed in E.coli, 50ug |
USD 249.00 |
{0} Product Review(s)
Be the first one to submit a review