HSD17B11 (NM_016245) Human Recombinant Protein

CAT#: TP305941L

Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 11 (HSD17B11), 1 mg

Size: 20 ug 100 ug 1 mg


USD 9,200.00

5 Days*

Size
    • 1 mg

Product Images

Frequently bought together (2)
Rabbit Polyclonal Anti-HSD17B11 Antibody
    • 100 ul

USD 539.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "HSD17B11"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC205941 representing NM_016245
Red=Cloning site Green=Tags(s)

MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK
HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT
FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG
VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV
LKRKISVKFDAVIGYKMKAQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_057329
Locus ID 51170
UniProt ID Q8NBQ5
Cytogenetics 4q22.1
Refseq Size 1701
Refseq ORF 900
Synonyms 17-BETA-HSD11; 17-BETA-HSDXI; 17BHSD11; DHRS8; PAN1B; RETSDR2; SDR16C2
Summary Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).[supplied by OMIM, Jun 2009]
Protein Families Druggable Genome, Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.