CMBL (NM_138809) Human Recombinant Protein
CAT#: TP301711
Recombinant protein of human carboxymethylenebutenolidase homolog (Pseudomonas) (CMBL), 20 µg
View other "CMBL" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201711 protein sequence
Red=Cloning site Green=Tags(s) MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNG YTTIVPDFFVGQEPWDPSGDWSIFPEWLKTRNAQKIDREISAILKYLKQQCHAQKIGIVGFCWGGTAVHH LMMKYSEFRAGVSVYGIVKDSEDIYNLKNPTLFIFAENDVVIPLKDVSLLTQKLKEHCKVEYQIKTFSGQ THGFVHRKREDCSPADKPYIDEARRNLIEWLNKYM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620164 |
Locus ID | 134147 |
UniProt ID | Q96DG6 |
Cytogenetics | 5p15.2 |
Refseq Size | 4047 |
Refseq ORF | 735 |
Synonyms | JS-1 |
Summary | CMBL (EC 3.1.1.45) is a cysteine hydrolase of the dienelactone hydrolase family that is highly expressed in liver cytosol. CMBL preferentially cleaves cyclic esters, and it activates medoxomil-ester prodrugs in which the medoxomil moiety is linked to an oxygen atom (Ishizuka et al., 2010 [PubMed 20177059]).[supplied by OMIM, Apr 2010] |
Protein Pathways | Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408494 | CMBL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408494 | Transient overexpression lysate of carboxymethylenebutenolidase homolog (Pseudomonas) (CMBL) |
USD 436.00 |
|
PH301711 | CMBL MS Standard C13 and N15-labeled recombinant protein (NP_620164) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review