MTFR1 (NM_001145838) Human Mass Spec Standard
CAT#: PH327926
MTFR1 MS Standard C13 and N15-labeled recombinant protein (NP_001139310)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227926 |
Predicted MW | 33 kDa |
Protein Sequence |
>RC227926 representing NM_001145838
Red=Cloning site Green=Tags(s) MLGWIKRLIRMVFQQVGVSMQSINSHATEWSPSHPGEDAVASFADVGWVAKEEGECSARLRTEVRSRPPL QDDLLFFEKAPSRQISLPDLSQEEPQLKTPALANEEALQKICALENELAALRAQIAKIVTQQEQQNLTAG DLDSTTFGTIPPHPPPPPPPLPPPALGLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILK EMNSVKLRSVKRSEQDVKPKPVDATDPAALIAEALKKKFAYRYRSDSQDEVEKGIPKSESEATSERVLFG PHMLKPTGKMKALIENVSDS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001139310 |
RefSeq ORF | 900 |
Synonyms | CHPPR; FAM54A2 |
Locus ID | 9650 |
UniProt ID | Q15390 |
Cytogenetics | 8q13.1 |
Summary | This gene encodes a mitochondrial protein that is characterized by a poly-proline rich region. A chicken homolog of this protein promotes mitochondrial fission and the mouse homolog protects cells from oxidative stress. A related pseudogene of this gene is found on chromosome X. [provided by RefSeq, Mar 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415142 | MTFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC429023 | MTFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415142 | Transient overexpression lysate of mitochondrial fission regulator 1 (MTFR1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY429023 | Transient overexpression lysate of mitochondrial fission regulator 1 (MTFR1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
TP327926 | Purified recombinant protein of Homo sapiens mitochondrial fission regulator 1 (MTFR1), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review