Cyclophilin F (PPIF) (NM_005729) Human Mass Spec Standard
CAT#: PH323397
PPIF MS Standard C13 and N15-labeled recombinant protein (NP_005720)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223397 |
Predicted MW | 22.04 kDa |
Protein Sequence |
>RC223397 representing NM_005729
Red=Cloning site Green=Tags(s) MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADV VPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVL SMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005720 |
RefSeq Size | 2213 |
RefSeq ORF | 621 |
Synonyms | Cyp-D; CyP-M; CYP3; CypD |
Locus ID | 10105 |
UniProt ID | P30405, A0A024QZS4 |
Cytogenetics | 10q22.3 |
Summary | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417109 | PPIF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417109 | Transient overexpression lysate of peptidylprolyl isomerase F (PPIF), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
TP323397 | Recombinant protein of human peptidylprolyl isomerase F (PPIF), nuclear gene encoding mitochondrial protein, 20 µg |
USD 867.00 |
|
TP760463 | Purified recombinant protein of Human peptidylprolyl isomerase F (PPIF), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review