C1orf172 (KDF1) (NM_152365) Human Mass Spec Standard

CAT#: PH318144

C1orf172 MS Standard C13 and N15-labeled recombinant protein (NP_689578)

Product Images

Coomassie blue staining of purified KDF1 protein (Cat# TP318144). The protein was produced from HEK293T cells transfected with KDF1 cDNA clone (Cat# RC218144) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218144
• Predicted MW: 43.5 kDa
• Protein Sequence:
  Sequence Link

  >RC218144 representing NM_152365
  Red=Cloning site Green=Tags(s)
  
  MPRPGHPRPASGPPRLGPWERPTELCLETYDKPPQPPPSRRTRRPDPKDPGHHGPESITFISGSAEPALE
  SPTCCLLWRPWVWEWCRAAFCFRRCRDCLQRCGACVRGCSPCLSTEDSTEGTAEANWAKEHNGVPPSPDR
  APPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSLPSTFASSP
  RGSEEYYSFHESDLDLPEMGSGSMSSREIDVLIFKKLTELFSVHQIDELAKCTSDTVFLEKTSKISDLIS
  SITQDYHLDEQDAEGRLVRGIIRISTRKSRARPQTSEGRSTRAAAPTAAAPDSGHETMVGSGLSQDELTV
  QISQETTADAIARKLRPYGAPGYPASHDSSFQGTDTDSSGAPLLQVYC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689578
• RefSeq Size: 1785
• RefSeq ORF: 1194
• Synonyms: C1orf172; ECTD12
• Locus ID: 126695
• UniProt ID: Q8NAX2
• Cytogenetics: 1p36.11
• Summary: Plays a role in the regulation of the epidermis formation during early development. Required both as an inhibitor of basal cell proliferation and a promoter of differentiation of basal progenitor cell progeny (By similarity).[UniProtKB/Swiss-Prot Function]