PTP4A3 (NM_007079) Human Mass Spec Standard
CAT#: PH317944
PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_009010)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217944 |
Predicted MW | 16.6 kDa |
Protein Sequence |
>RC217944 representing NM_007079
Red=Cloning site Green=Tags(s) MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHT HKTRCCVM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009010 |
RefSeq Size | 1321 |
RefSeq ORF | 444 |
Synonyms | PRL-3; PRL-R; PRL3 |
Locus ID | 11156 |
UniProt ID | O75365 |
Cytogenetics | 8q24.3 |
Summary | This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410006 | PTP4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416216 | PTP4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410006 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1 |
USD 436.00 |
|
LY416216 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2 |
USD 436.00 |
|
PH312193 | PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_116000) |
USD 3,255.00 |
|
TP312193 | Recombinant protein of human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1, 20 µg |
USD 867.00 |
|
TP317944 | Recombinant protein of human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2, 20 µg |
USD 867.00 |
|
TP761759 | Purified recombinant protein of Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review