ELMO1 (NM_014800) Human Mass Spec Standard
CAT#: PH315541
ELMO1 MS Standard C13 and N15-labeled recombinant protein (NP_055615)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215541 |
Predicted MW | 83.6 kDa |
Protein Sequence |
>RC215541 representing NM_014800
Red=Cloning site Green=Tags(s) MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFYITEKNRNEIK NGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERY QKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKKIASFVNKSAIDISILQRSLAILESMVL NSHDLYQKVAQEITIGQLIPHLQGSDQEIQTYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVI RAQRAINNEMAHQLYVLQVLTFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKS MYTRDYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVMQVVKEQVMR ALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPEILELIKQQRLNRLVEGT CFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGA LKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLD LENIQIPDAPPPIPKEPSNYDFVYDCN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055615 |
RefSeq Size | 3727 |
RefSeq ORF | 2181 |
Synonyms | CED-12; CED12; ELMO-1 |
Locus ID | 9844 |
UniProt ID | Q92556, A4D1X5 |
Cytogenetics | 7p14.2-p14.1 |
Summary | This gene encodes a member of the engulfment and cell motility protein family. These proteins interact with dedicator of cytokinesis proteins to promote phagocytosis and cell migration. Increased expression of this gene and dedicator of cytokinesis 1 may promote glioma cell invasion, and single nucleotide polymorphisms in this gene may be associated with diabetic nephropathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403326 | ELMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC415009 | ELMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC422048 | ELMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403326 | Transient overexpression lysate of engulfment and cell motility 1 (ELMO1), transcript variant 2 |
USD 436.00 |
|
LY415009 | Transient overexpression lysate of engulfment and cell motility 1 (ELMO1), transcript variant 1 |
USD 665.00 |
|
LY422048 | Transient overexpression lysate of engulfment and cell motility 1 (ELMO1), transcript variant 3 |
USD 436.00 |
|
PH315722 | ELMO1 MS Standard C13 and N15-labeled recombinant protein (NP_001034548) |
USD 3,255.00 |
|
TP315541 | Recombinant protein of human engulfment and cell motility 1 (ELMO1), transcript variant 1, 20 µg |
USD 867.00 |
|
TP315722 | Recombinant protein of human engulfment and cell motility 1 (ELMO1), transcript variant 3, 20 µg |
USD 867.00 |
|
TP760401 | Purified recombinant protein of Human engulfment and cell motility 1 (ELMO1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review