SPANXA1 (NM_013453) Human Mass Spec Standard
CAT#: PH311653
SPANXA1 MS Standard C13 and N15-labeled recombinant protein (NP_038481)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211653 |
Predicted MW | 11 kDa |
Protein Sequence |
>RC211653 protein sequence
Red=Cloning site Green=Tags(s) MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLND HARENRINPLQMEEEEFMEIMVEIPAK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_038481 |
RefSeq Size | 418 |
RefSeq ORF | 291 |
Synonyms | CT11.1; CT11.3; NAP-X; SPAN-X; SPAN-Xa; SPAN-Xb; SPANX; SPANX-A |
Locus ID | 30014 |
UniProt ID | Q9NS26 |
Cytogenetics | Xq27.2 |
Summary | Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-head orientation with SPANX family member A2, which appears to be a duplication of the A1 locus. The protein encoded by this gene targets to the nucleus where it associates with nuclear vacuoles and the redundant nuclear envelope. Based on its association with these poorly characterized regions of the sperm nucleus, this protein provides a biochemical marker to study unique structures in spermatazoa while attempting to further define its role in spermatogenesis. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415587 | SPANXA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415587 | Transient overexpression lysate of sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1) |
USD 436.00 |
|
TP311653 | Recombinant protein of human sperm protein associated with the nucleus, X-linked, family member A1 (SPANXA1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review