SPC24 (NM_182513) Human Mass Spec Standard
CAT#: PH311241
SPC24 MS Standard C13 and N15-labeled recombinant protein (NP_872319)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211241 |
Predicted MW | 22.4 kDa |
Protein Sequence |
>RC211241 protein sequence
Red=Cloning site Green=Tags(s) MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAK EQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVA QLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_872319 |
RefSeq Size | 654 |
RefSeq ORF | 591 |
Synonyms | SPBC24 |
Locus ID | 147841 |
UniProt ID | Q8NBT2 |
Cytogenetics | 19p13.2 |
Summary | Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:14738735). Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore (PubMed:14738735). The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules (PubMed:23085020).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405531 | SPC24 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405531 | Transient overexpression lysate of SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae) (SPC24) |
USD 436.00 |
|
TP311241 | Recombinant protein of human SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae) (SPC24), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review