SPC24 (NM_182513) Human Tagged ORF Clone

CAT#: RC211241

SPC24 (Myc-DDK-tagged)-Human SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae) (SPC24)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_182513" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


SPC24 Rabbit polyclonal Antibody
    • 100 ul

USD 365.00

Other products for "SPC24"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SPC24
Synonyms SPBC24
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211241 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCCTTCCGCGACATAGAGGAGGTGAGCCAGGGGCTGCTCAGCCTGCTGGGCGCCAACCGCGCGG
AGGCGCAGCAGCGACGGCTGCTGGGGCGCCACGAGCAGGTGGTGGAGCGGCTGCTGGAAACGCAAGACGG
TGCCGAGAAGCAGCTGCGAGAGATCCTCACCATGGAGAAGGAAGTGGCCCAGAGCCTTCTCAATGCGAAG
GAGCAGGTGCACCAGGGAGGCGTGGAGCTGCAGCAGCTGGAAGCTGGGCTTCAGGAGGCTGGGGAGGAGG
ACACCCGTCTGAAGGCCAGCCTCCTTCAGCTCACCAGAGAGCTGGAAGAGCTCAAGGAGATTGAGGCGGA
TCTGGAGCGACAGGAGAAGGAGGTCGACGAGGACACGACAGTCACAATCCCCTCGGCCGTGTACGTGGCT
CAACTTTACCACCAAGTTAGTAAAATTGAGTGGGATTATGAGTGTGAGCCAGGGATGGTCAAAGGCATCC
ATCATGGCCCCAGTGTGGCCCAGCCCATCCACCTGGACAGCACCCAGCTCTCCAGGAAATTCATCAGCGA
CTACCTCTGGAGTCTGGTGGACACCGAGTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211241 protein sequence
Red=Cloning site Green=Tags(s)

MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAK
EQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVA
QLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_182513
ORF Size 591 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_182513.3, NP_872319.1
RefSeq Size 654 bp
RefSeq ORF 594 bp
Locus ID 147841
UniProt ID Q8NBT2
Cytogenetics 19p13.2
Protein Families Druggable Genome
MW 22.4 kDa
Gene Summary Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:14738735). Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore (PubMed:14738735). The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules (PubMed:23085020).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.