CCL3 (NM_002983) Human Mass Spec Standard
CAT#: PH310026
CCL3 MS Standard C13 and N15-labeled recombinant protein (NP_002974)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210026 |
Predicted MW | 10.1 kDa |
Protein Sequence |
>RC210026 protein sequence
Red=Cloning site Green=Tags(s) MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSR QVCADPSEEWVQKYVSDLELSA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002974 |
RefSeq Size | 813 |
RefSeq ORF | 276 |
Synonyms | G0S19-1; LD78ALPHA; MIP-1-alpha; MIP1A; SCYA3 |
Locus ID | 6348 |
UniProt ID | P10147, A0N0R1 |
Cytogenetics | 17q12 |
Summary | This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418970 | CCL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418970 | Transient overexpression lysate of chemokine (C-C motif) ligand 3 (CCL3) |
USD 436.00 |
|
TP310026 | Recombinant protein of human chemokine (C-C motif) ligand 3 (CCL3), 20 µg |
USD 867.00 |
|
TP720049 | Recombinant protein of human chemokine (C-C motif) ligand 3 (CCL3) |
USD 330.00 |
|
TP790113 | Purified recombinant protein of Human chemokine (C-C motif) ligand 3 (CCL3), esidues 24-92aa, with N-terminal His tag, secretory expressed in HEK293 cells, 50ug |
USD 871.00 |
{0} Product Review(s)
Be the first one to submit a review