TRM11 (TRMT11) (NM_001031712) Human Mass Spec Standard

CAT#: PH308923

TRMT11 MS Standard C13 and N15-labeled recombinant protein (NP_001026882)

Product Images

Coomassie blue staining of purified TRMT11 protein (Cat# TP308923). The protein was produced from HEK293T cells transfected with TRMT11 cDNA clone (Cat# RC208923) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208923
• Predicted MW: 53.4 kDa
• Protein Sequence:
  Sequence Link

  >RC208923 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALSCTLNRYLLLMAQEHLEFRLPEIKSLLLLFGGQFASSQETYGKSPFWILSIPSEDIARNLMKRTVCA
  KSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKV
  NLKKPQHVFSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANH
  GKVKENDIVFDPFVGTGGLQIACAHFGAYVYGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLE
  KYYLDVLVSDASKPSWRKGTYFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLS
  DMFLDLLNFAAETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLELVSNCEQKLSSHTSRRLITMEKVKKFE
  NRDQYSHLLSDHFLPYQGHNSFREKYFSGVTKRIAKEEKSTQE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001026882
• RefSeq Size: 1967
• RefSeq ORF: 1389
• Synonyms: C6orf75; MDS024; TRM11; TRMT11-1
• Locus ID: 60487
• UniProt ID: Q7Z4G4
• Cytogenetics: 6q22.32
• Summary: Catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Androgen and estrogen metabolism, Histidine metabolism, Selenoamino acid metabolism, Tyrosine metabolism