PCBD2 (NM_032151) Human Mass Spec Standard
CAT#: PH308859
PCBD2 MS Standard C13 and N15-labeled recombinant protein (NP_115527)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208859 |
Predicted MW | 14.4 kDa |
Protein Sequence |
>RC208859 protein sequence
Red=Cloning site Green=Tags(s) MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNF NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115527 |
RefSeq Size | 2395 |
RefSeq ORF | 390 |
Synonyms | DCOH2; DCOHM; PHS2 |
Locus ID | 84105 |
UniProt ID | Q9H0N5 |
Cytogenetics | 5q31.1 |
Summary | Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2 (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403146 | PCBD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403146 | Transient overexpression lysate of pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 (PCBD2) |
USD 436.00 |
|
TP308859 | Recombinant protein of human pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 (PCBD2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review