MEIS2 (NM_170676) Human Mass Spec Standard
CAT#: PH308386
MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733776)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208386 |
Predicted MW | 51.1 kDa |
Protein Sequence |
>RC208386 protein sequence
Red=Cloning site Green=Tags(s) MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVN DALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSN PELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNL ADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKR GIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGA AYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHS YLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_733776 |
RefSeq Size | 3256 |
RefSeq ORF | 1410 |
Synonyms | CPCMR; HsT18361; MRG1 |
Locus ID | 4212 |
UniProt ID | O14770, A0A024R9L4, B3KPD8 |
Cytogenetics | 15q14 |
Summary | This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406902 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC406903 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC406904 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC406905 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419351 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406902 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant b |
USD 436.00 |
|
LY406903 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant c |
USD 665.00 |
|
LY406904 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant d |
USD 436.00 |
|
LY406905 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant a |
USD 436.00 |
|
LY419351 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant f |
USD 436.00 |
|
PH301395 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_002390) |
USD 3,255.00 |
|
PH322807 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733777) |
USD 3,255.00 |
|
TP301395 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant f, 20 µg |
USD 867.00 |
|
TP308386 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant d, 20 µg |
USD 867.00 |
|
TP322807 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant a, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review