Spasmolytic Polypeptide (TFF2) (NM_005423) Human Mass Spec Standard
CAT#: PH307571
TFF2 MS Standard C13 and N15-labeled recombinant protein (NP_005414)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207571 |
Predicted MW | 14.3 kDa |
Protein Sequence |
>RC207571 protein sequence
Red=Cloning site Green=Tags(s) MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF HPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005414 |
RefSeq Size | 717 |
RefSeq ORF | 387 |
Synonyms | SML1; SP |
Locus ID | 7032 |
UniProt ID | Q03403 |
Cytogenetics | 21q22.3 |
Summary | Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417317 | TFF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417317 | Transient overexpression lysate of trefoil factor 2 (TFF2) |
USD 436.00 |
|
TP307571 | Recombinant protein of human trefoil factor 2 (TFF2), 20 µg |
USD 867.00 |
|
TP720721 | Purified recombinant protein of Human trefoil factor 2 (TFF2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review