SMAD9 (NM_005905) Human Mass Spec Standard

CAT#: PH304143

SMAD9 MS Standard C13 and N15-labeled recombinant protein (NP_005896)

Product Images

Coomassie blue staining of purified SMAD9 protein (Cat# TP304143). The protein was produced from HEK293T cells transfected with SMAD9 cDNA clone (Cat# RC204143) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204143
• Predicted MW: 48.6 kDa
• Protein Sequence:
  Sequence Link

  >RC204143 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVT
  IPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLP
  PVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSP
  GSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLS
  NVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNN
  QLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMG
  SPHNPISSVS
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005896
• RefSeq Size: 5481
• RefSeq ORF: 1290
• Synonyms: MADH6; MADH9; PPH2; SMAD8; SMAD8/9; SMAD8A; SMAD8B
• Locus ID: 4093
• UniProt ID: O15198, A0A024RDR3
• Cytogenetics: 13q13.3
• Summary: The protein encoded by this gene is a member of the SMAD family, which transduces signals from TGF-beta family members. The encoded protein is activated by bone morphogenetic proteins and interacts with SMAD4. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2010]
• Protein Families: ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway