PSMD10 (NM_002814) Human Mass Spec Standard
CAT#: PH302025
PSMD10 MS Standard C13 and N15-labeled recombinant protein (NP_002805)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202025 |
Predicted MW | 24.4 kDa |
Protein Sequence |
>RC202025 protein sequence
Red=Cloning site Green=Tags(s) MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD DAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEA TAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQ VAKGGLGLILKRMVEG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002805 |
RefSeq Size | 1585 |
RefSeq ORF | 678 |
Synonyms | dJ889N15.2; p28; p28(GANK) |
Locus ID | 5716 |
UniProt ID | O75832 |
Cytogenetics | Xq22.3 |
Summary | This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.[provided by RefSeq, Mar 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406867 | PSMD10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419094 | PSMD10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406867 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 2 |
USD 436.00 |
|
LY419094 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 1 |
USD 436.00 |
|
PH317359 | PSMD10 MS Standard C13 and N15-labeled recombinant protein (NP_736606) |
USD 3,255.00 |
|
TP302025 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 1, 20 µg |
USD 867.00 |
|
TP317359 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 2, 20 µg |
USD 867.00 |
|
TP720144 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review