Antibodies

View as table Download

Anti-PSMD10 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PSMD10 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against Gankyrin

Applications FC, ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human gankyrin protein sequence (between residues 100-200). UniProt O75832

Rabbit polyclonal Anti-PSMD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD10 antibody: synthetic peptide directed towards the middle region of human PSMD10. Synthetic peptide located within the following region: MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLV

Anti-PSMD10 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Psmd10 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse