HSBP1 (NM_001537) Human Mass Spec Standard
CAT#: PH301399
HSBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001528)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201399 |
Predicted MW | 8.5 kDa |
Protein Sequence |
>RC201399 protein sequence
Red=Cloning site Green=Tags(s) MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKI PATQKS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001528 |
RefSeq Size | 1989 |
RefSeq ORF | 228 |
Synonyms | NPC-A-13 |
Locus ID | 3281 |
UniProt ID | O75506 |
Cytogenetics | 16q23.3 |
Summary | The heat-shock response is elicited by exposure of cells to thermal and chemical stress and through the activation of HSFs (heat shock factors) results in the elevated expression of heat-shock induced genes. Heat shock factor binding protein 1 (HSBP1), is a 76-amino-acid protein that binds to heat shock factor 1(HSF1), which is a transcription factor involved in the HS response. During HS response, HSF1 undergoes conformational transition from an inert non-DNA-binding monomer to active functional trimers. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulate HSF1 DNA-binding activity. Overexpression of HSBP1 in mammalian cells represses the transactivation activity of HSF1. When overexpressed in C.elegans HSBP1 has severe effects on survival of the animals after thermal and chemical stress consistent with a role of HSBP1 as a negative regulator of heat shock response. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419869 | HSBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419869 | Transient overexpression lysate of heat shock factor binding protein 1 (HSBP1) |
USD 436.00 |
|
TP301399 | Recombinant protein of human heat shock factor binding protein 1 (HSBP1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review