TRUB2 (NM_015679) Human Mass Spec Standard

CAT#: PH300105

TRUB2 MS Standard C13 and N15-labeled recombinant protein (NP_056494)

Product Images

Coomassie blue staining of purified TRUB2 protein (Cat# TP300105). The protein was produced from HEK293T cells transfected with TRUB2 cDNA clone (Cat# RC200105) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200105
• Predicted MW: 36.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200105 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTAT
  SVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDD
  FREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITG
  IRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQ
  DAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056494
• RefSeq Size: 1439
• RefSeq ORF: 993
• Synonyms: CLONE24922
• Locus ID: 26995
• UniProt ID: O95900, A0A024R886
• Cytogenetics: 9q34.11
• Summary: Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]).[supplied by OMIM, Mar 2008]