Wilms Tumor Protein (WT1) (NM_024426) Human Mutant ORF Clone

CAT#: RC403435

  • TrueORF®

WT1 Mutant (S118X), Myc-DDK-tagged ORF clone of Homo sapiens Wilms tumor 1 (WT1), transcript variant D as transfection-ready DNA


Reconstitution Protocol

USD 225.00

2 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Mutation Description S118X
Affected Codon# 118
Affected NT# 353
Tag Myc-DDK
Effect Wilms tumour
Symbol WT1
Synonyms AWT1; GUD; NPHS4; WAGR; WIT-2; WT33
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Vector pCMV6-Entry
ACCN NM_024426
ORF Size 351 bp
Sequence Data
>RC403435 representing NM_024426
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGACCCGGCTTCCACGTGTGTCCCGGAGCCGGCGTCTCAGCACACGCTCCGCTCCGGGCCTGGGT
GCCTACAGCAGCCAGAGCAGCAGGGAGTCCGGGACCCGGGCGGCATCTGGGCCAAGTTAGGCGCCGCCGA
GGCCAGCGCTGAACGTCTCCAGGGCCGGAGGAGCCGCGGGGCGTCCGGGTCTGAGCCGCAGCAAATGGGC
TCCGACGTGCGGGACCTGAACGCGCTGCTGCCCGCCGTCCCCTCCCTGGGTGGCGGCGGCGGCTGTGCCC
TGCCTGTGAGCGGCGCGGCGCAGTGGGCGCCGGTGCTGGACTTTGCGCCCCCGGGCGCTTCGGCTTACGG
G


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC403435 representing NM_024426
Red=Cloning site Green=Tags(s)

MQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGASGSEPQQMG
SDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYG

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reference Data
RefSeq NP_077744
RefSeq Size 351 bp
RefSeq ORF 1569 bp
Locus ID 7490
Cytogenetics 11p13
Domains WT1, zf-C2H2
Protein Families Druggable Genome, Transcription Factors
MW 12.9 kDa
Gene Summary This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilms tumor. This gene exhibits complex tissue-specific and polymorphic imprinting pattern, with biallelic, and monoallelic expression from the maternal and paternal alleles in different tissues. Multiple transcript variants have been described. In several variants, there is evidence for the use of a non-AUG (CUG) translation initiation codon upstream of, and in-frame with the first AUG. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated. [provided by RefSeq, Mar 2015]

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.