Glucokinase (GCK) (NM_000162) Human Mutant ORF Clone

CAT#: RC401155

  • TrueORF®

GCK Mutant (Y61X), Myc-DDK-tagged ORF clone of Homo sapiens glucokinase (hexokinase 4) (GCK), transcript variant 1 as transfection-ready DNA


Reconstitution Protocol

USD 150.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "Glucokinase"

Specifications

Product Data
Mutation Description Y61X
Affected Codon# 61
Affected NT# 183
Tag Myc-DDK
Effect Diabetes, MODY
Symbol Glucokinase
Synonyms FGQTL3; GK; GLK; HHF3; HK4; HKIV; HXKP; LGLK; MODY2; PNDM1
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Vector pCMV6-Entry
ACCN NM_000162
ORF Size 180 bp
Sequence Data
>RC401155 representing NM_000162
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGACGACAGAGCCAGGATGGAGGCCGCCAAGAAGGAGAAGGTAGAGCAGATCCTGGCAGAGTTCC
AGCTGCAGGAGGAGGACCTGAAGAAGGTGATGAGACGGATGCAGAAGGAGATGGACCGCGGCCTGAGGCT
GGAGACCCATGAAGAGGCCAGTGTGAAGATGCTGCCCACC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC401155 representing NM_000162
Red=Cloning site Green=Tags(s)

MLDDRARMEAAKKEKVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPT

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NP_000153
RefSeq Size 180 bp
RefSeq ORF 1398 bp
Locus ID 2645
Cytogenetics 7p13
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Glycolysis / Gluconeogenesis, Insulin signaling pathway, Maturity onset diabetes of the young, Metabolic pathways, Starch and sucrose metabolism, Type II diabetes mellitus
MW 6.6 kDa
Gene Summary This gene encodes a member of the hexokinase family of proteins. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. In contrast to other forms of hexokinase, this enzyme is not inhibited by its product glucose-6-phosphate but remains active while glucose is abundant. The use of multiple promoters and alternative splicing of this gene result in distinct protein isoforms that exhibit tissue-specific expression in the pancreas and liver. In the pancreas, this enzyme plays a role in glucose-stimulated insulin secretion, while in the liver, this enzyme is important in glucose uptake and conversion to glycogen. Mutations in this gene that alter enzyme activity have been associated with multiple types of diabetes and hyperinsulinemic hypoglycemia. [provided by RefSeq, Aug 2017]

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.