Eif6 (NM_001037352) Rat Tagged ORF Clone

CAT#: RR215605

Eif6 (Myc-DDK-tagged ORF) - Rat eukaryotic translation initiation factor 6 (Eif6), (10 ug)

Product Images

Circular map for RR215605

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Eif6
• Synonyms: eIF-6; Itgb4bp
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR215605 representing NM_001037352
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGTCAGAGCGTCGTTCGAGAACAACTGTGAGGTCGGTTGTTTTGCCAAACTCACTAACACCTACT
  GCCTGGTGGCCATCGGAGGGTCAGAGAACTTCTACAGTGTGTTCGAGGGCGAGCTCTCCGATACCATTCC
  TGTAGTGCACGCATCCATCGCCGGCTGCCGAATCATCGGGCGCATGTGTGTGGGGAACAGGCATGGGCTG
  CTGGTACCCAACAACACCACCGACCAGGAGCTGCAGCATATCCGCAACAGCCTTCCGGATTCAGTGCAGA
  TACGGCGGGTAGAGGAGCGGCTCTCAGCCCTTGGCAATGTCACCACCTGCAATGACTATGTGGCCTTGGT
  CCACCCAGACTTGGATAGGGAGACAGAAGAAATCCTGGCTGATGTGCTCAAGGTGGAAGTCTTCAGGCAG
  ACGGTTGCTGACCAGGTGTTAGTTGGAAGCTACTGTGTCTTCAGTAATCAAGGAGGTCTGGTGCACCCTA
  AAACTTCGATCGAGGATCAGGATGAGCTGTCCTCCCTTCTTCAGGTTCCCCTTGTGGCAGGCACTGTGAA
  CCGAGGGAGCGAGGTGATTGCTGCCGGGATGGTAGTGAATGATTGGTGTGCTTTCTGTGGCCTGGACACG
  ACCAGCACAGAGCTGTCAGTGGTGGAGAGTGTCTTCAAGCTGAATGAAGCCAAACCTAGCACCATTGCCA
  CCAGCATGCGGGACTCCCTCATTGACAGCCTCACA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR215605 representing NM_001037352
  Red=Cloning site Green=Tags(s)
  
  MAVRASFENNCEVGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGL
  LVPNNTTDQELQHIRNSLPDSVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQ
  TVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT
  TSTELSVVESVFKLNEAKPSTIATSMRDSLIDSLT
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001037352
• ORF Size: 735 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001037352.1, NP_001032429.1
• RefSeq Size: 1254 bp
• RefSeq ORF: 738 bp
• Locus ID: 305506
• UniProt ID: Q3KRD8
• Cytogenetics: 3q42
• MW: 26.6 kDa
• Gene Summary: Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. Behaves as a stimulatory translation initiation factor downstream insulin/growth factors. Is also involved in ribosome biogenesis. Associates with pre-60S subunits in the nucleus and is involved in its nuclear export. Cytoplasmic release of TIF6 from 60S subunits and nuclear relocalization is promoted by a RACK1 (RACK1)-dependent protein kinase C activity. In tissues responsive to insulin, controls fatty acid synthesis and glycolysis by exerting translational control of adipogenic transcription factors such as CEBPB, CEBPD and ATF4 that have G/C rich or uORF in their 5'UTR. Required for ROS-dependent megakaryocyte maturation and platelets formation, controls the expression of mitochondrial respiratory chain genes involved in reactive oxygen species (ROS) synthesis. Involved in miRNA-mediated gene silencing by the RNA-induced silencing complex (RISC). Required for both miRNA-mediated translational repression and miRNA-mediated cleavage of complementary mRNAs by RISC. Modulates cell cycle progression and global translation of pre-B cells, its activation seems to be rate-limiting in tumorigenesis and tumor growth.[UniProtKB/Swiss-Prot Function]