EXOC7 (NM_001282314) Human Tagged ORF Clone

CAT#: RG236166

  • TrueORF®

EXOC7 (tGFP-tagged) - Human exocyst complex component 7 (EXOC7), transcript variant 7

ORF Plasmid: DDK tGFP


  "NM_001282314" in other vectors (2)

Reconstitution Protocol

USD 365.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Goat Polyclonal Antibody against EXOC7
    • 100 ug

USD 520.00

Other products for "EXOC7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol EXOC7
Synonyms 2-5-3p; BLOM4; EX070; EXO70; Exo70p; EXOC1; NEDSEBA; YJL085W
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG236166 representing NM_001282314.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGATTCCCCCACAGGAGGCATCCGCTCGACGGCGGGAGATTGAGGACAAGCTGAAGCAGGAGGAGGAG
ACTCTGTCCTTCATCCGAGACAGCCTGGAGAAGAGCGACCAGCTCACTAAGAACATGGTGTCTATCTTA
TCATCCTTTGAGAGCCGCCTTATGAAGCTGGAGAACTCCATCATCCCTGTGCACAAGCAGACGGAGAAT
CTGCAGCGGCTGCAGGAGAATGTTGAGAAGACGCTGTCCTGCCTGGACCATGTCATCAGCTACTACCAT
GTGGCCAGTGACACTGAGAAGATCATCAGAGAGGGCCCCACAGGTAGGCTGGAAGAGTACCTGGGAAGC
ATGGCCAAGATTCAGAAGGCAGTGGAGTATTTCCAGGACAACAGCCCAGACAGCCCGGAACTCAACAAA
GTGGTAAGGGGTCCGCAGAATAACGTGAGAAGCTTGGGGATATCAGTCTCTGCCCTGGTCTCA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
>Peptide sequence encoded by RG236166
Blue=ORF Red=Cloning site Green=Tag(s)

MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTEN
LQRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNK
VVRGPQNNVRSLGISVSALVS

TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV

Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001282314
ORF Size 477 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reference Data
RefSeq NM_001282314.2
RefSeq Size 771 bp
RefSeq ORF 480 bp
Locus ID 23265
Cytogenetics 17q25.1
Protein Families Druggable Genome
Protein Pathways Insulin signaling pathway
MW 18.6 kDa
Gene Summary The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4. [provided by RefSeq, Nov 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.