LYNX1 (NM_177457) Human Tagged ORF Clone

CAT#: RG218661

LYNX1 (tGFP-tagged) - Human Ly6/neurotoxin 1 (LYNX1), transcript variant 3

Product Images

Circular map for RG218661

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: LYNX1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG218661 representing NM_177457
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACGCCCCTGCTCACCCTGATCCTGGTGGTCCTCATGGGCTTACCTCTGGCCCAGGCCTTGGACTGCC
  ACGTGTGTGCCTACAACGGAGACAACTGCTTCAACCCCATGCGCTGCCCGGCTATGGTTGCCTACTGCAT
  GACCACGCGCACCTACTACACCCCCACCAGGATGAAGGTCAGTAAGTCCTGCGTGCCCCGCTGCTTCGAG
  ACTGTGTATGATGGCTACTCCAAGCACGCGTCCACCACCTCCTGCTGCCAGTACGACCTCTGCAACGGCA
  CCGGCCTTGCCACCCCGGCCACCCTGGCCCTGGCCCCCATCCTCCTGGCCACCCTCTGGGGTCTCCTC
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG218661 representing NM_177457
  Red=Cloning site Green=Tags(s)
  
  MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMKVSKSCVPRCFE
  TVYDGYSKHASTTSCCQYDLCNGTGLATPATLALAPILLATLWGLL
  
  SGPTRTRRLE - GFP Tag - V
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_177457
• ORF Size: 348 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_177457.5
• RefSeq Size: 4967 bp
• RefSeq ORF: 351 bp
• Locus ID: 66004
• UniProt ID: P0DP58
• Cytogenetics: 8q24.3
• Protein Families: Druggable Genome
• Gene Summary: This gene encodes a GPI-anchored, cell membrane bound member of the Ly6/uPAR (LU) superfamily of proteins containing the unique three-finger LU domain. This protein interacts with nicotinic acetylcholine receptors (nAChRs), and is thought to function as a modulator of nAChR activity to prevent excessive excitation. Alternatively spliced transcript variants have been found for this gene. Read-through transcription between this gene and the neighboring downstream gene (SLURP2) generates naturally-occurring transcripts (LYNX1-SLURP2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Sep 2017]