C14orf151 (INF2) (NM_032714) Human Tagged ORF Clone

CAT#: RG218469

  • TrueORF®

INF2 (tGFP-tagged) - Human inverted formin, FH2 and WH2 domain containing (INF2), transcript variant 3

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_032714" in other vectors (6)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


INF2 rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "C14orf151"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol C14orf151
Synonyms C14orf151; C14orf173; CMTDIE; FSGS5; pp9484
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG218469 representing NM_032714
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGTGAAGGAGGGCGCACAGCGCAAGTGGGCAGCGCTGAAGGAGAAGCTGGGGCCACAGGATTCGG
ACCCCACGGAGGCCAACCTGGAGAGCGCGGACCCTGAGCTGTGCATCCGGCTGCTCCAGATGCCCTCTGT
GGTCAACTACTCCGGCCTGCGCAAGCGCCTGGAGGGCAGCGACGGCGGCTGGATGGTGCAGTTCCTGGAG
CAGAGCGGCCTGGACCTGCTGCTGGAGGCGCTGGCGCGGCTGTCGGGCCGCGGCGTTGCACGTATCTCCG
ACGCCCTGCTGCAGCTCACCTGCGTCAGCTGCGTGCGCGCCGTCATGAACTCGCGGCAGGGCATCGAGTA
CATCCTCAGCAACCAGGGCTACGTGCGCCAGCTCTCCCAGGCCCTGGACACATCCAACGTGATGGTGAAG
AAGCAGGTGTTTGAGCTACTGGCTGCCCTGTGCATCTACTCTCCCGAGGGCCACGTGCTGACCCTGGACG
CCCTGGACCACTACAAGACGGTGTGCAGCCAGCAGTACCGCTTCAGCATTGTCATGAACGAGCTCTCCGG
CAGCGACAACGTGCCCTACGTGGTCACCCTGCTTAGCGTGATCAACGCCGTCATCTTGGGCCCCGAGGAC
CTGCGCGCGCGCACCCAGCTGCGGAACGAGTTTATCGGGCTGCAGCTGCTGGACGTCCTGGCTCGCCTGC
GG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG218469 representing NM_032714
Red=Cloning site Green=Tags(s)

MSVKEGAQRKWAALKEKLGPQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLEGSDGGWMVQFLE
QSGLDLLLEALARLSGRGVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVK
KQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPED
LRARTQLRNEFIGLQLLDVLARLR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_032714
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032714.1, NP_116103.1
RefSeq Size 1704 bp
RefSeq ORF 705 bp
Locus ID 64423
UniProt ID Q27J81
Cytogenetics 14q32.33
Protein Families Druggable Genome
Gene Summary This gene represents a member of the formin family of proteins. It is considered a diaphanous formin due to the presence of a diaphanous inhibitory domain located at the N-terminus of the encoded protein. Studies of a similar mouse protein indicate that the protein encoded by this locus may function in polymerization and depolymerization of actin filaments. Mutations at this locus have been associated with focal segmental glomerulosclerosis 5.[provided by RefSeq, Aug 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.