NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone

CAT#: RG203854

  • TrueORF®

RASSF5 (tGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_182665" in other vectors (7)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
    • 100 ul

USD 447.00

Other products for "NORE1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol NORE1
Synonyms Maxp1; NORE1; NORE1A; NORE1B; RAPL; RASSF3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG203854 representing NM_182665
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGTGGACAGCAGCATGAGCAGTGGGTACTGCAGCCTGGACGAGGAACTGGAAGACTGCTTCTTCA
CTGCTAAGACTACCTTTTTCAGAAATGCGCAGAGCAAACATCTTTCAAAGAATGTCTGTAAACCTGTGGA
GGAGACACAGCGCCCGCCCACACTGCAGGAGATCAAGCAGAAGATCGACAGCTACAACACGCGAGAGAAG
AACTGCCTGGGCATGAAACTGAGTGAAGACGGCACCTACACGGGTTTCATCAAAGTGCATCTGAAACTCC
GGCGGCCTGTGACGGTGCCTGCTGGGATCCGGCCCCAGTCCATCTATGATGCCATCAAGGAGGTGAACCT
GGCGGCTACCACGGACAAGCGGACATCCTTCTACCTGCCCCTAGATGCCATCAAGCAGCTGCACATCAGC
AGCACCACCACCGTCAGTGAGGTCATCCAGGGGCTGCTCAAGAAGTTCATGGTTGTGGACAATCCCCAGA
AGTTTGCACTTTTTAAGCGGATACACAAGGACGGACAAGTGCTCTTCCAGAAACTCTCCATTGCTGACCG
CCCCCTCTACCTGCGCCTGCTTGCTGGGCCTGACACGGAGGTCCTCAGCTTTGTGCTAAAGGAGAATGAA
ACTGGAGAGGTAGAGTGGGATGCCTTCTCCATCCCTGAACTTCAGAACTTCCTAACAATCCTGGAAAAAG
AGGAGCAGGACAAAATCCAACAAGTGCAAAAGAAGTATGACAAGTTTAGGCAGAAACTGGAGGAGGCCTT
AAGAGAATCCCAGGGCAAACCTGGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203854 representing NM_182665
Red=Cloning site Green=Tags(s)

MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREK
NCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHIS
STTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENE
TGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_182665
ORF Size 795 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_182665.4
RefSeq Size 3531 bp
RefSeq ORF 798 bp
Locus ID 83593
UniProt ID Q8WWW0
Cytogenetics 1q32.1
Protein Families Druggable Genome
Protein Pathways Leukocyte transendothelial migration, Non-small cell lung cancer, Pathways in cancer
Gene Summary This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras, Rap1, and several other Ras-like small GTPases. The protein regulates lymphocyte adhesion and suppresses cell growth in response to activated Rap1 or Ras. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.