Centrin 3 (CETN3) (NM_001297765) Human Tagged ORF Clone

CAT#: RC236436

CETN3 (myc-DDK-tagged) - Human centrin, EF-hand protein, 3 (CETN3), transcript variant 1

Product Images

Circular map for RC236436

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Centrin 3
• Synonyms: CDC31; CEN3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC236436 representing NM_001297765
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTTTAGCTCTGAGAAGTGAGCTTGTAGTGGACAAAACAAAGAGGAAAAAAAGAAGAGAACTGTCTG
  AGGAACAGAAACAAGAAATTAAAGATGCTTTTGAACTATTTGATACAGACAAAGATGAAGCAATAGATTA
  TCATGAATTAAAGGTGGCAATGAGAGCCTTGGGGTTTGATGTAAAAAAAGCTGATGTACTGAAGATTCTT
  AAAGATTATGACAGAGAAGCCACAGGGAAAATCACCTTTGAAGATTTTAATGAAGTTGTGACAGACTGGA
  TATTGGAAAGAGATCCCCATGAAGAAATACTCAAGGCATTTAAACTATTTGATGATGATGATTCAGGTAA
  AATAAGCTTGAGGAATTTGCGACGTGTTGCTAGAGAATTGGGTGAAAACATGAGTGATGAAGAACTTCGA
  GCTATGATAGAAGAATTTGACAAAGATGGTGATGGAGAAATTCTTAAGAACATACTCTTGCTTCCTATTT
  GGTCTAGATGCCTCAGTCTAAATCGGGAGTTCTTCAGTGAAGTAAACCAAGAGGAGTTCATTGCTATTAT
  GACTGGTGACATT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC236436 representing NM_001297765
  Red=Cloning site Green=Tags(s)
  
  MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKIL
  KDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELR
  AMIEEFDKDGDGEILKNILLLPIWSRCLSLNREFFSEVNQEEFIAIMTGDI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001297765
• ORF Size: 573 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001297765.1, NP_001284694.1
• RefSeq Size: 1446 bp
• RefSeq ORF: 576 bp
• Locus ID: 1070
• Cytogenetics: 5q14.3
• Protein Families: Druggable Genome
• MW: 22.9 kDa
• Gene Summary: The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]