DUSP6 (NM_022652) Human Tagged ORF Clone

CAT#: RC216245

  • TrueORF®

DUSP6 (Myc-DDK-tagged)-Human dual specificity phosphatase 6 (DUSP6), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_022652" in other vectors (4)

Reconstitution Protocol

USD 330.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Anti-DUSP6 Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00

Other products for "DUSP6"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DUSP6
Synonyms HH19; MKP3; PYST1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216245 representing NM_022652
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATAGATACGCTCAGACCCGTGCCCTTCGCGTCGGAAATGGCGATCAGCAAGACGGTGGCGTGGCTCA
ACGAGCAGCTGGAGCTGGGCAACGAGCGGCTGCTGCTGATGGACTGCCGGCCGCAGGAGCTATACGAGTC
GTCGCACATCGAGTCGGCCATCAACGTGGCCATCCCGGGCATCATGCTGCGGCGCCTGCAGAAGGGTAAC
CTGCCGGTGCGCGCGCTCTTCACGCGCGGCGAGGACCGGGACCGCTTCACCCGGCGCTGTGGCACCGACA
CAGTGGTGCTCTACGACGAGAGCAGCAGCGACTGGAACGAGAATACGGGCGGCGAGTCGGTGCTCGGGCT
GCTGCTCAAGAAGCTCAAGGACGAGGGCTGCCGGGCGTTCTACCTGGAAGATGAAGCCCGGGGCAAGAAC
TGTGGTGTCTTGGTACATTGCTTGGCTGGCATTAGCCGCTCAGTCACTGTGACTGTGGCTTACCTTATGC
AGAAGCTCAATCTGTCGATGAACGATGCCTATGACATTGTCAAAATGAAAAAATCCAACATATCCCCTAA
CTTCAACTTCATGGGTCAGCTGCTGGACTTCGAGAGGACGCTGGGACTCAGCAGCCCATGTGACAACAGG
GTTCCAGCACAGCAGCTGTATTTTACCACCCCTTCCAACCAGAATGTATACCAGGTGGACTCTCTGCAAT
CTACG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216245 representing NM_022652
Red=Cloning site Green=Tags(s)

MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGN
LPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEDEARGKN
CGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNR
VPAQQLYFTTPSNQNVYQVDSLQST

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022652
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022652.4
RefSeq Size 2404 bp
RefSeq ORF 708 bp
Locus ID 1848
UniProt ID Q16828
Cytogenetics 12q21.33
Domains DSPc, RHOD
Protein Families Druggable Genome, Phosphatase
Protein Pathways MAPK signaling pathway
MW 26.3 kDa
Gene Summary The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK2, is expressed in a variety of tissues with the highest levels in heart and pancreas, and unlike most other members of this family, is localized in the cytoplasm. Mutations in this gene have been associated with congenital hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.