SEPTIN4 (NM_080415) Human Tagged ORF Clone

CAT#: RC215054

SEPT4 (Myc-DDK-tagged)-Human septin 4 (SEPT4), nuclear gene encoding mitochondrial protein, transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_080415" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Septin 4 Rabbit polyclonal Antibody
    • 100 ul

USD 365.00

Other products for "SEPTIN4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SEPTIN4
Synonyms ARTS; BRADEION; C17orf47; CE5B3; H5; hCDCREL-2; hucep-7; MART; PNUTL2; SEP4; SEPT4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215054 representing NM_080415
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCAAGCGTTTCCTGGAGGACACCACGGATGATGGAGAACTGAGCAAGTTCGTGAAGGATTTCTCAG
GAAATGCGAGCTGCCACCCACCAGAGGCTAAGACCTGGGCATCCAGGCCCCAAGTCCCGGAGCCAAGGCC
CCAGGCCCCGGACCTCTATGATGATGACCTGGAGTTCAGACCCCCCTCGCGGCCCCAGTCCTCTGACAAC
CAGCAGTACTTCTGTGCCCCAGCCCCTCTCAGCCCATCTGCCAGGCCCCGCAGCCCATGGGGCAAGCTTG
ATCCCTATGATTCCTCTGAGGATGACAAGGAGTATGTGGGCTTTGCAACCCTCCCCAACCAAGTCCACCG
AAAGTCCGTGAAGAAAGGCTTTGACTTTACCCTCATGGTGGCAGGAGAGTCTGGCCTGGGCAAATCCACA
CTTGTCAATAGCCTCTTCCTCACTGATCTGTACCGGGACCGGAAACTTCTTGGTGCTGAAGAGAGGATCA
TGCAAACTGTGGAGATCACTAAGCATGCAGTGGACATAGAAGAGAAGGGTGTGAGGCTGCGGCTCACCAT
TGTGGACACACCAGGTTTTGGGGATGCAGTCAACAACACAGAGTGCTGGAAGCCTGTGGCAGAATACATT
GATCAGCAGTTTGAGCAGTATTTCCGAGACGAGAGTGGCCTGAACCGAAAGAACATCCAAGACAACAGGG
TGCACTGCTGCCTGTACTTTATCTCACCCTTCGGCCATGGGTATGGTCCAAGCCTGAGGCTCCTGGCACC
ACCGGGTGCTGTCAAGGGAACAGGCCAAGAGCACCAGGGGCAGGGCTGCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215054 representing NM_080415
Red=Cloning site Green=Tags(s)

MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDN
QQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKST
LVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYI
DQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGYGPSLRLLAPPGAVKGTGQEHQGQGCH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_080415
ORF Size 822 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_080415.3
RefSeq Size 1911 bp
RefSeq ORF 825 bp
Locus ID 5414
UniProt ID O43236
Cytogenetics 17q22
Domains GTP_CDC
MW 30.6 kDa
Gene Summary This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer. [provided by RefSeq, Nov 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.