APOL3 (NM_145641) Human Tagged ORF Clone

CAT#: RC212625

APOL3 (Myc-DDK-tagged)-Human apolipoprotein L, 3 (APOL3), transcript variant beta/a

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_145641" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Goat Anti-APOL3 Antibody
    • 100 ug

USD 520.00

Other products for "APOL3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol APOL3
Synonyms apoL-III; APOLIII; CG12_1; CG121
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC212625 representing NM_145641
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCTTGCTGGTCTTGTTTTGGCACCATTTACAGCAGGGACGAGTCTGGCCCTTACTGCAGCTGGGG
TAGGGCTGGGAGCAGCGTCTGCTGTGACTGGGATCACCACCAGCATCGTGGAGCACTCATATACATCATC
AGCAGAAGCTGAAGCCAGCAGGCTGACTGCAACCAGCATTGACCGATTGAAGGTATTTAAGGAAGTTATG
CGTGACATCACACCCAACTTACTTTCCCTTCTTAATAATTATTACGAAGCCACACAAACCATTGGGAGTG
AAATCCGTGCCATCAGGCAAGCCAGAGCCAGGGCCCGACTCCCTGTGACCACCTGGCGAATCTCAGCTGG
AAGTGGTGGTCAAGCAGAGAGAACGATTGCAGGCACCACCCGGGCAGTGAGCAGAGGAGCCCGGATCCTG
AGTGCGACCACTTCAGGCATCTTCCTTGCACTGGATGTGGTCAACCTTGTATACGAGTCAAAGCACTTGC
ATGAGGGGGCAAAGTCTGCATCTGCTGAGGAGCTGAGGCGGCAGGCTCAGGAGCTGGAGGAGAATCTAAT
GGAGCTCACTCAGATCTATCAGCGTCTGAATCCATGCCATACCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212625 representing NM_145641
Red=Cloning site Green=Tags(s)

MSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVM
RDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARIL
SATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_145641
ORF Size 606 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_145641.2
RefSeq Size 3627 bp
RefSeq ORF 609 bp
Locus ID 80833
UniProt ID O95236
Cytogenetics 22q12.3
MW 21.4 kDa
Gene Summary This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.