MXI1 (NM_130439) Human Tagged ORF Clone

CAT#: RC207319

MXI1 (Myc-DDK-tagged)-Human MAX interactor 1 (MXI1), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_130439" in other vectors (5)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal anti-MXI1 antibody
    • 100 ul

USD 539.00

Other products for "MXI1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MXI1
Synonyms bHLHc11; MAD2; MXD2; MXI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207319 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAAACGCGGGCGGCCGCGCAAGGAGGCGCGCTGCGAGGGCGCGGGGCTGGCCCCCGCCGCGCCCC
CGGCTGTGCCCCCCGCCGTGGCCGCGCCCCAGCCCCCGGCCCTGCCCGAGGACCCCGCTGGGGCCAAGCC
CAGGTGCCCCTTCTCAGACATTTTCAACACCAGCGAGAACTCGATGGAGAAGCACATCAACACTTTTCTG
CAGAACGTGCAGATTCTGCTCGAGGCCGCCAGCTACCTGGAGCAGATCGAGAAAGAAAACAAAAAGTGTG
AACATGGCTACGCCTCTTCATTCCCGTCCATGCCGAGCCCCCGACTGCAGCATTCAAAGCCCCCACGGAG
GTTGAGCCGGGCACAGAAACACAGCAGCGGGAGCAGCAACACCAGCACTGCCAACAGATCTACACACAAT
GAGCTGGAAAAGAATCGACGAGCTCATCTGCGCCTTTGTTTAGAACGCTTAAAAGTTCTGATTCCACTAG
GACCAGACTGCACCCGGCACACAACACTTGGTTTGCTCAACAAAGCCAAAGCACACATCAAGAAACTTGA
AGAAGCTGAAAGAAAAAGCCAGCACCAGCTCGAGAATTTGGAACGAGAACAGAGATTTTTAAAGTGGCGA
CTGGAACAGCTGCAGGGTCCTCAGGAGATGGAACGAATACGAATGGACAGCATTGGATCAACTATTTCTT
CAGATCGTTCTGATTCAGAGCGAGAGGAGATTGAAGTGGATGTTGAAAGCACAGAGTTCTCCCATGGAGA
AGTGGACAATATAAGTACCACCAGCATCAGTGACATTGATGACCACAGCAGCCTGCCGAGTATTGGGAGT
GACGAGGGTTACTCCAGTGCCAGTGTCAAACTTTCATTCACTTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207319 protein sequence
Red=Cloning site Green=Tags(s)

MGKRGRPRKEARCEGAGLAPAAPPAVPPAVAAPQPPALPEDPAGAKPRCPFSDIFNTSENSMEKHINTFL
QNVQILLEAASYLEQIEKENKKCEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHN
ELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWR
LEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGS
DEGYSSASVKLSFTS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_130439
ORF Size 885 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_130439.3, NP_569157.2
RefSeq Size 3470 bp
RefSeq ORF 888 bp
Locus ID 4601
UniProt ID P50539
Cytogenetics 10q25.2
Domains HLH
Protein Families Druggable Genome, Transcription Factors
MW 32.8 kDa
Gene Summary Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.