PEX7 (NM_000288) Human Tagged ORF Clone

CAT#: RC202432

PEX7 (Myc-DDK-tagged)-Human peroxisomal biogenesis factor 7 (PEX7)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_000288" in other vectors (7)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit polyclonal anti-PEX7 antibody
    • 100 ul

USD 380.00

Other products for "PEX7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PEX7
Synonyms PBD9B; PTS2R; RCDP1; RD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202432 representing NM_000288
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGCGGTGTGCGGTGGAGCGGCGCGGATGCTGCGGACGCCGGGACGCCACGGCTACGCCGCCGAGT
TCTCCCCGTACCTGCCGGGCCGCCTGGCCTGCGCCACCGCGCAGCACTACGGCATCGCGGGCTGTGGAAC
CCTACTAATATTGGATCCAGATGAAGCTGGGCTAAGGCTTTTTAGAAGCTTTGACTGGAATGATGGTTTG
TTTGATGTGACTTGGAGTGAGAACAACGAACATGTCCTCATCACCTGTAGTGGCGATGGCTCGCTGCAGC
TCTGGGACACTGCCAAAGCTGCAGGGCCACTGCAAGTCTATAAAGAACACGCTCAGGAGGTGTATAGTGT
TGATTGGAGCCAAACCAGAGGTGAACAGCTTGTGGTGTCTGGCTCATGGGATCAAACTGTCAAATTGTGG
GATCCAACTGTTGGAAAGTCTCTGTGCACCTTTAGAGGCCATGAAAGTATTATTTATAGCACAATCTGGT
CTCCCCACATCCCTGGTTGTTTTGCTTCAGCCTCAGGTGATCAGACTCTGAGAATATGGGATGTGAAGGC
AGCAGGAGTAAGAATCGTGATTCCTGCACATCAGGCAGAAATCTTGAGTTGTGACTGGTGTAAATACAAT
GAGAATTTGCTGGTGACCGGGGCGGTTGACTGTAGTTTGAGAGGCTGGGACTTAAGGAATGTACGACAAC
CAGTGTTTGAACTTCTTGGTCATACCTATGCTATTAGGAGGGTGAAATTTTCACCATTTCATGCTTCTGT
GCTGGCCTCTTGCTCGTATGATTTTACTGTAAGATTCTGGAACTTTTCAAAGCCTGACTCTCTTCTTGAA
ACAGTGGAGCATCATACAGAGTTTACTTGTGGTTTAGACTTCAGTCTTCAGAGCCCCACTCAGGTGGCTG
ACTGTTCTTGGGATGAAACAATAAAGATCTATGACCCTGCTTGTCTTACTATTCCTGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202432 representing NM_000288
Red=Cloning site Green=Tags(s)

MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGL
FDVTWSENNEHVLITCSGDGSLQLWDTAKAAGPLQVYKEHAQEVYSVDWSQTRGEQLVVSGSWDQTVKLW
DPTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKYN
ENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLE
TVEHHTEFTCGLDFSLQSPTQVADCSWDETIKIYDPACLTIPA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000288
ORF Size 969 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000288.4
RefSeq Size 1451 bp
RefSeq ORF 972 bp
Locus ID 5191
UniProt ID O00628
Cytogenetics 6q23.3
Domains WD40
Protein Families Druggable Genome
MW 35.7 kDa
Gene Summary This gene encodes the cytosolic receptor for the set of peroxisomal matrix enzymes targeted to the organelle by the peroxisome targeting signal 2 (PTS2). Defects in this gene cause peroxisome biogenesis disorders (PBDs), which are characterized by multiple defects in peroxisome function. There are at least 14 complementation groups for PBDs, with more than one phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene have been associated with PBD complementation group 11 (PBD-CG11) disorders, rhizomelic chondrodysplasia punctata type 1 (RCDP1), and Refsum disease (RD). [provided by RefSeq, Oct 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.