SNAP29 (NM_004782) Human Tagged ORF Clone

CAT#: RC202179

SNAP29 (Myc-DDK-tagged)-Human synaptosomal-associated protein, 29kDa (SNAP29)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_004782" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-SNAP29 Antibody
    • 100 ul

USD 380.00

Other products for "SNAP29"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SNAP29
Synonyms CEDNIK; SNAP-29
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202179 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGCTTACCCTAAGAGCTACAATCCGTTCGACGACGACGGGGAGGACGAAGGCGCCCGGCCGGCCC
CTTGGAGGGACGCCCGAGACCTCCCCGACGGGCCCGACGCGCCCGCGGACAGGCAGCAGTACTTGCGGCA
GGAGGTCCTCCGCAGGGCTGAGGCCACGGCCGCCAGCACCAGCAGGTCCCTGGCCCTCATGTACGAGTCC
GAGAAGGTTGGGGTCGCCTCTTCCGAGGAGCTCGCCCGTCAGCGAGGAGTCCTGGAGCGCACAGAGAAGA
TGGTGGACAAGATGGACCAAGATTTGAAGATCAGCCAGAAACACATCAATAGCATTAAGAGCGTGTTTGG
GGGGCTGGTCAATTACTTCAAATCCAAACCAGTAGAGACCCCACCTGAACAGAATGGCACCCTCACCTCC
CAGCCCAACAACAGATTGAAAGAAGCTATAAGTACAAGTAAAGAACAGGAAGCAAAGTACCAGGCCAGCC
ACCCAAACCTTAGAAAGCTGGATGATACAGACCCTGTCCCCAGAGGGGCTGGTTCTGCCATGAGTACTGA
TGCTTACCCAAAGAACCCACACCTTCGAGCCTATCACCAGAAGATCGACAGCAACCTAGATGAGCTGTCC
ATGGGACTGGGTCGTCTGAAGGACATAGCCCTGGGGATGCAGACAGAAATTGAGGAGCAAGATGACATTC
TTGACCGGCTGACAACCAAAGTGGACAAGTTAGATGTCAACATAAAAAGCACAGAAAGAAAAGTTCGACA
ACTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202179 protein sequence
Red=Cloning site Green=Tags(s)

MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYES
EKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTS
QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELS
MGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004782
ORF Size 774 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004782.4
RefSeq Size 4277 bp
RefSeq ORF 777 bp
Locus ID 9342
UniProt ID O95721
Cytogenetics 22q11.21
Domains t_SNARE, SNAP-25
Protein Families Druggable Genome
Protein Pathways SNARE interactions in vesicular transport
MW 29 kDa
Gene Summary This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.