Lair1 (NM_001302683) Mouse Tagged ORF Clone

CAT#: MR228136

  • TrueORF®

Lair1 (myc-DDK-tagged) - Mouse leukocyte-associated Ig-like receptor 1 (Lair1), transcript variant h


  "NM_001302683" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 165.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Lair1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Lair1
Synonyms 5133400O11Rik; BB115266; D7Bwg0421e; Lair-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR228136 representing NM_001302683
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGGAAGGAGACCCTTGAATATTTCCTGTAATCATAAACACTCTCAACTATATACATCTTGGCTAA
AGACATACAGCATTTACATTTTTACTGTGGTCTCTGTGATTTTCCTCCTTTGTCTTTCCGCCCTTCTGTT
CTGCTTCCTCAGGCACCGTCAGAAAAAGCAGGGACTCCCAAACAACAAAAGACAGCAGCAGAGGCCAGAA
GAGAGGCTAAATCTAGCTACTAATGGCCTGGAGATGACTCCAGACATAGTTGCAGATGACAGGCTTCCTG
AGGACAGATGGACAGAAACCTGGACCCCAGTTGCAGGAGACCTTCAAGAGGTGACGTATATCCAGCTGGA
CCATCACTCCCTCACACAGAGGGCAGTCGGAGCTGTGACCTCACAGAGCACAGATATGGCTGAGTCCAGC
ACATATGCAGCCATCATCAGACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR228136 representing NM_001302683
Red=Cloning site Green=Tags(s)

MPGRRPLNISCNHKHSQLYTSWLKTYSIYIFTVVSVIFLLCLSALLFCFLRHRQKKQGLPNNKRQQQRPE
ERLNLATNGLEMTPDIVADDRLPEDRWTETWTPVAGDLQEVTYIQLDHHSLTQRAVGAVTSQSTDMAESS
TYAAIIRH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001302683
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001302683.1, NP_001289612.1
RefSeq Size 3303 bp
RefSeq ORF 447 bp
Locus ID 52855
UniProt ID Q8BG84
Cytogenetics 7 2.31 cM
MW 17.5 kDa
Gene Summary Functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of natural killer (NK) cells, B-cells and T-cells. Activation by Tyr phosphorylation results in recruitment and activation of the phosphatases PTPN6 and PTPN11. It also reduces the increase of intracellular calcium evoked by B-cell receptor ligation. May also play its inhibitory role independently of SH2-containing phosphatases. Modulates cytokine production in CD4+ T-cells, down-regulating IL2 and IFNG production while inducing secretion of transforming growth factor beta. Down-regulates also IgG and IgE production in B-cells as well as IL8, IL10 and TNF secretion. Inhibits proliferation and induces apoptosis in myeloid leukemia cell lines as well as prevents nuclear translocation of NF-kappa-B p65 subunit/RELA and phosphorylation of I-kappa-B alpha/CHUK in these cells. Inhibits the differentiation of peripheral blood precursors towards dendritic cells (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.