Kcnmb1 (NM_031169) Mouse Tagged ORF Clone

CAT#: MR201831

Kcnmb1 (Myc-DDK-tagged) - Mouse potassium large conductance calcium-activated channel, subfamily M, beta member 1 (Kcnmb1)

Product Images

Circular map for MR201831

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Kcnmb1
• Synonyms: BKbeta1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201831 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGGAAGAAGCTGGTGATGGCCCAGAAGCGCGGAGAGACACGAGCCCTCTGCCTGGGAGTGGCAATGG
  TAGTGTGTGCTGCCATCACCTACTACGTCCTGGGTACAACTGTGCTGCCCCTCTACCAGAAAAGTGTGTG
  GACCCAGGAATCCATATGTCACTTGATTGAAACTAATATCAAGGACCAGGAAGAGCTGGAGGGCAAGAAG
  GTGCCCCAGTACCCATGCCTTTGGGTCAATGTATCAGCTGTGGGCAGATGGGCCATGCTGTATCACACGG
  AAGACACTCGGGATCAAAACCAACAGTGCTCCTATATCCCCAGGAACCTGGACAACTACCAGACAGCCTT
  GGCAGATGTGAAGAAGGTCAGAGCCAATTTCTATAAGCACCATGAATTCTATTGCCTTTCTGCACCTCAA
  GTCAACGAGACCAGCGTCGTGTACCAGCGCCTCTACGGGCCCCAAGTCCTCCTCTTCTCCTTCTTCTGGC
  CCACCTTCCTGCTGACTGGGGGTCTTCTTCTTATTGCCATGGTGAAGCTCAACAGGTCCCTATCCATCTT
  GGCAGCTCAGAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201831 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKKLVMAQKRGETRALCLGVAMVVCAAITYYVLGTTVLPLYQKSVWTQESICHLIETNIKDQEELEGKK
  VPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALADVKKVRANFYKHHEFYCLSAPQ
  VNETSVVYQRLYGPQVLLFSFFWPTFLLTGGLLLIAMVKLNRSLSILAAQK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_031169
• ORF Size: 576 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_031169.1, NM_031169.2, NM_031169.3, NM_031169.4, NP_112446.2
• RefSeq Size: 4188 bp
• RefSeq ORF: 576 bp
• Locus ID: 16533
• UniProt ID: Q8CAE3
• Cytogenetics: 11 A4
• MW: 21.8 kDa
• Gene Summary: Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate.[UniProtKB/Swiss-Prot Function]