Cd3g (NM_009850) Mouse Tagged ORF Clone

CAT#: MR201641

Cd3g (Myc-DDK-tagged) - Mouse CD3 antigen, gamma polypeptide (Cd3g)

Product Images

Circular map for MR201641

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cd3g
• Synonyms: Ctg-3; Ctg3; T3g
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201641 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGCAGAGGAAGGGTCTGGCTGGCCTCTTCCTGGTGATCTCTCTTCTTCAAGGCACTGTAGCCCAGA
  CAAATAAAGCAAAGAATTTGGTACAAGTGGATGGCAGCCGAGGAGACGGTTCTGTACTTCTGACTTGTGG
  CTTGACTGACAAGACTATCAAGTGGCTTAAAGACGGGAGCATAATAAGTCCTCTAAATGCAACTAAAAAC
  ACATGGAATCTGGGCAACAATGCCAAAGACCCTCGAGGCACGTATCAGTGTCAAGGAGCAAAGGAGACAT
  CAAACCCCCTGCAAGTGTATTACAGAATGTGTGAAAACTGCATTGAGCTAAACATAGGCACCATATCCGG
  CTTTATCTTCGCTGAGGTCATCAGCATCTTCTTCCTTGCTCTTGGTGTATATCTCATTGCGGGACAGGAT
  GGAGTTCGCCAGTCAAGAGCTTCAGACAAGCAGACTCTGTTGCAAAATGAACAGCTGTACCAGCCCCTCA
  AGGACCGGGAATATGACCAGTACAGCCATCTCCAAGGAAACCAACTGAGGAAGAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201641 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEQRKGLAGLFLVISLLQGTVAQTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKN
  TWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTISGFIFAEVISIFFLALGVYLIAGQD
  GVRQSRASDKQTLLQNEQLYQPLKDREYDQYSHLQGNQLRKK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_009850
• ORF Size: 549 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_009850.2
• RefSeq Size: 1023 bp
• RefSeq ORF: 549 bp
• Locus ID: 12502
• UniProt ID: P11942
• Cytogenetics: 9 24.84 cM
• MW: 20.2 kDa
• Gene Summary: Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G (PubMed:25920998).[UniProtKB/Swiss-Prot Function]