Isca1 (BC018547) Mouse Tagged ORF Clone

CAT#: MR200712

Isca1 (Myc-DDK-tagged) - Mouse iron-sulfur cluster assembly 1 homolog (S

Product Images

Circular map for MR200712

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Isca1
• Synonyms: 1810010A06Rik; Hbld2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200712 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCGGCGTCGTTGGTCCGCGCCACCGTGCGGGCTGTGAGCAAGAGAAAACTGCAGCCCACGCGGGCGG
  CCCTCACACTGACCCCCTCTGCTGTAAACAAGATAAAACAACTTCTTAAAGACAAACCTGAGCATGTGGG
  TCTGAAAGTTGGCGTGCGAACCAGGGGCTGTAATGGCCTCTCTTACAGCCTGGAGTACACAAAGACAAAA
  GGAGATTCTGATGAAGAAGTTATTCAAGATGGAGTCCGAGTGTTCATCGAGAAGAAAGCACAGCTAACCC
  TGTTAGGAACAGAGATGGACTATGTGGAAGACAAACTGTCCAGTGAGTTTGTGTTCAATAACCCCAACAT
  CAAGGGAACCTGTGGCTGCGGTGAGAGCTTTCACGTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200712 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTK
  GDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFHV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC018547
• ORF Size: 387 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
• Note: Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required.

Reference Data

• RefSeq: BC018547, AAH18547
• RefSeq Size: 1901 bp
• RefSeq ORF: 389 bp
• Locus ID: 69046
• Cytogenetics: 13 B2
• MW: 14.2 kDa
• Gene Summary: Involved in the maturation of mitochondrial 4Fe-4S proteins functioning late in the iron-sulfur cluster assembly pathway. Probably involved in the binding of an intermediate of Fe/S cluster assembly.[UniProtKB/Swiss-Prot Function]