Mouse Ccng1 (BC005534) AAV Particle

CAT#: MR203177A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, Ccng1 (Myc-DDK-tagged) - Mouse cyclin G1 (cDNA clone MGC:7684 IMAGE:3497034), 250ul, >10^13 GC/mL

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro



Interest in protein/lysate? Submit request here!


Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50 ul
    • 50 ul

USD 427.00


pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 850.00

Other products for "Ccng1"

Specifications

Product Data
Tag Myc-DDK
Symbol Ccng1
Synonyms Ccng, cyclin G
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>MR203177 representing BC005534
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC



ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203177 representing BC005534
Red=Cloning site Green=Tags(s)

MTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKATEEERNVP
LATDLIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLVHDTLPFERRNDLNFERLEAQL
KACHCRIIFSKAKPSVLALSILALEIQALKYVELTEGVECIQKHSKISGRDLTFWQELVSKCLTEYSSNK
CSKPNGQKLKWIVSGRTARQLKHSYYRITHLPTIPETIC

myc-FLAG tag
Species Mouse
Serotype AAV-2
ACCN BC005534
ORF Size 747 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq BC005534, AAH05534
RefSeq Size 3151 bp
RefSeq ORF 749 bp
Locus ID 12450
Cytogenetics 11 A5
MW 115.5 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.