CUTC Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of cutC copper transporter homolog (E. coli) (CUTC)
USD 436.00
Recombinant protein of human cutC copper transporter homolog (E. coli) (CUTC), 20 µg
USD 867.00
Other products for "CUTC"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CUTC antibody: synthetic peptide directed towards the middle region of human CUTC. Synthetic peptide located within the following region: LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 29 kDa |
Gene Name | cutC copper transporter |
Database Link | |
Background | Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807]; Li et al., 2005 [PubMed 16182249]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: BC028948.1, AF132966.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## |
Synonyms | CGI-32 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.