NOP10 Rabbit Polyclonal Antibody

CAT#: TA344845

Rabbit Polyclonal Anti-NOLA3 Antibody - middle region

Product Images

WB Suggested Anti-NOLA3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateNOP10 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NOLA3 antibody: synthetic peptide directed towards the middle region of human NOLA3. Synthetic peptide located within the following region: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 8 kDa
• Gene Name: NOP10 ribonucleoprotein
• Database Link:
  NP_061118
  Entrez Gene 55505 Human
  UniProt ID Q9NPE3
• Background: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl
• Synonyms: DKCB1; NOLA3; NOP10P
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%; Yeast: 79%