BMP2K Rabbit Polyclonal Antibody

CAT#: TA344135

Rabbit Polyclonal Anti-BMP2K Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human BMP2 inducible kinase (BMP2K), transcript variant 1, 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of BMP2 inducible kinase (BMP2K), transcript variant 1
    • 100 ug

USD 665.00

Other products for "BMP2K"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BMP2K antibody: synthetic peptide directed towards the middle region of human BMP2K. Synthetic peptide located within the following region: VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 74 kDa
Gene Name BMP2 inducible kinase
Background BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms BIKE; HRIHFB2017
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Rat: 92%; Horse: 83%; Zebrafish: 82%
Reference Data
Protein Families Druggable Genome, Protein Kinase

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.