BMP2K Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human BMP2 inducible kinase (BMP2K), transcript variant 1, 20 µg
USD 867.00
Transient overexpression lysate of BMP2 inducible kinase (BMP2K), transcript variant 1
USD 665.00
Other products for "BMP2K"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BMP2K antibody: synthetic peptide directed towards the middle region of human BMP2K. Synthetic peptide located within the following region: VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 74 kDa |
Gene Name | BMP2 inducible kinase |
Database Link | |
Background | BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. |
Synonyms | BIKE; HRIHFB2017 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Rat: 92%; Horse: 83%; Zebrafish: 82% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.