Germany
Japan
United Kingdom
China
FAM71D Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Transient overexpression lysate of family with sequence similarity 71, member D (FAM71D)
USD 665.00
Other products for "FAM71D"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-FAM71D antibody: synthetic peptide directed towards the middle region of human FAM71D. Synthetic peptide located within the following region: VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 46 kDa |
| Gene Name | family with sequence similarity 71 member D |
| Database Link | |
| Background | The specific function of the protein remains unknown. |
| Synonyms | C14orf54 |
| Note | Immunogen Sequence Homology: Human: 100%; Pig: 92%; Guinea pig: 92%; Rat: 82%; Dog: 77%; Horse: 77% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.