XRN1 Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "XRN1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-XRN1 antibody: synthetic peptide directed towards the middle region of human XRN1. Synthetic peptide located within the following region: LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 194 kDa |
Gene Name | 5'-3' exoribonuclease 1 |
Database Link | |
Background | SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.SEP1 localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-67 BX640905.1 1-67 68-5188 AY137776.1 1-5121 5189-5269 BG197321.1 308-388 5270-10092 AC023508.16 31718-36540 c |
Synonyms | SEP1 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Bovine: 92%; Horse: 90%; Yeast: 90%; Mouse: 86%; Pig: 85%; Guinea pig: 79% |
Reference Data | |
Protein Pathways | RNA degradation |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.