E2F6 Rabbit Polyclonal Antibody

CAT#: TA343159

Rabbit Polyclonal Anti-E2F6 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of E2F transcription factor 6 (E2F6)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "E2F6"

Specifications

Product Data
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-E2f6 antibody is: synthetic peptide directed towards the middle region of Rat E2f6. Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name E2F transcription factor 6
Background Mouse homolog is a transcription factor and is involved in the regulation of cell cycle progression.
Synonyms E2F-6
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 85%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.